VIP

$125.00 Inc GST

RADAR BIO LABS features exceptional purity and premium batch standards, complete with third-party COA verification.

Dispatched rapidly from NSW, QLD, or VIC warehouses (within 24 hours). Free Australia Post express shipping with tracking included on orders above $200.

Earn up to 63 points.
- +

Buy VIP Australia – High Purity Research Peptide 10mg

VIP (Vasoactive Intestinal Peptide) is a 28-amino-acid neuropeptide belonging to the secretin-glucagon family. It is widely studied in laboratory settings for its diverse roles as a neurotransmitter and neuromodulator, particularly in vasodilation, anti-inflammatory responses, gastrointestinal motility, neuroendocrine regulation, and immune system modulation. Researchers investigate VIP for its interactions with VPAC1 and VPAC2 receptors and its involvement in pulmonary, neural, and inflammatory pathway models.

≥99% Purity (HPLC Verified) | Lyophilized Powder | Laboratory Research Only
Supplied as a stable, white lyophilized powder with exceptional batch consistency and solubility, it enables precise in vitro research into receptor signaling, smooth muscle relaxation, cytokine modulation, and neuroprotective mechanisms.

Product Highlights

  • Purity: ≥99% (verified by HPLC analysis)
  • Form: White lyophilized powder
  • Solubility: Excellent in sterile water (H₂O) or bacteriostatic water
  • Sequence: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂ (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂)
  • Molecular Formula: C₁₄₇H₂₃₈N₄₄O₄₂S
  • Molecular Weight: ~3325.8 g/mol
  • CAS Number: 40077-57-4
  • Manufacturing: Produced under GMP-compliant standards
  • Intended Use: Advanced research on VPAC receptor signaling, anti-inflammatory pathways, vasodilation models, gastrointestinal function, and neuroendocrine regulation

Storage & Handling Store sealed and dry at 2–8°C (or -20°C for long-term storage), protected from light and moisture. Once reconstituted with bacteriostatic water, refrigerate at 2–8°C and use within 4–6 weeks for optimal stability. Avoid repeated freeze-thaw cycles.

Why Australian Researchers Choose Radar Bio Labs – VIP 10mg

  • Independently verified purity with COA available
  • Fast dispatch from Queensland
  • Secure & discreet Australia-wide shipping
  • Premium vacuum-sealed vials

Important Disclaimer This product is strictly for in vitro laboratory research use only by qualified professionals. It is not for human consumption, nor for diagnostic, therapeutic, veterinary, or supplemental purposes. No claims are made regarding safety or efficacy in any application. By purchasing, you confirm compliance with all applicable regulations and assume full responsibility for safe handling and use.

Singles

10MG

Reviews

There are no reviews yet.

Be the first to review “VIP”

Your email address will not be published. Required fields are marked *

Scroll to Top